HORDB

ID: hor000083
Uniprot ID: P13389
Protein name: Oxytocin
Gene name: OXT
Organism: Ovis aries (Sheep)
Family: Vasopressin/oxytocin family
Source: animal
Expression: hypothalamus
Disease: NA
Comments: NA
Taxonomy: Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
GO BP: GO:0007165 signal transduction; GO:0009612 response to mechanical stimulus; GO:0032094 response to food; GO:0043207 response to external biotic stimulus; GO:0120162 positive regulation of cold-induced thermogenesis
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence: CYIQNCPLG
Length: 9
Propeptide: MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCREENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHADPACDPEAAFSQH
Signal peptide: MAGSSLACCLLGLLALTSA
Modification: T9 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Function: Causes contraction of the smooth muscle of the uterus and of the mammary gland
Mechanism: Acts by binding to oxytocin receptors
Cross BBB: NO
Target: NA
Target Unid: NA
IC50: Prostaglandin F metabolite(PGFM) release on administeration of 10 iu of oxytocin= 18.48±3.62 pg/ml ( PubMed ID: 10454085 )
EC50: NA
ED50: NA
kd: NA
Half life: 6.78 minutes; /406.8 seconds ( PubMed ID: 10454085 )

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-P01186-F1.pdb

hor000083_AF2.pdb

hor000083_ESM.pdb

Mass:	115308	Formula:	C43H67N11O13S2
Absent amino acids:	ADEFHKMRSTVW	Common amino acids:	C
pI:	5.81	Basic residues:	0
Polar residues:	5	Hydrophobic residues:	2
Hydrophobicity:	33.33	Boman Index:	102
Half-Life:	1.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	86.67
Instability Index:	2708.89	Extinction Coefficient cystines:	1615
Absorbance 280nm:	201.88